DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and UBP19

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_565576.1 Gene:UBP19 / 817000 AraportID:AT2G24640 Length:672 Species:Arabidopsis thaliana


Alignment Length:615 Identity:154/615 - (25%)
Similarity:246/615 - (40%) Gaps:118/615 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLADC 210
            ||..||:|.|:. :.:...:|......|:.|.||:|:.|..||.|.....|..:|: |:.|..:|
plant   149 KPTDVLFPYESF-VRYYNWDRPIMAPCGLTNCGNSCFANVVLQCLSWTRPLVAYLL-ERGHKREC 211

  Fly   211 NVAEPGSGCIICAMTKTLLATQSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMER 275
               .....|.:|.....|.....::....|..|.|:|..|..::..||||||||.:||.::.|:.
plant   212 ---RRNDWCFLCEFENHLDRANYSRFPFSPMNIISRLPNIGGNLGYGRQEDAHELMRFAIDMMQS 273

  Fly   276 AYLMRFRNYKELDQLVKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIR-KADSLED 339
            ..|..|...|.:....:|||.:..||||.|:|:|:|.:|::||..:::..||.::|. .|.|||:
plant   274 VCLDEFGGEKVVPPRAQETTLIQYIFGGLLQSQVQCTACSNVSDQYENMMDLTVEIHGDAVSLEE 338

  Fly   340 AFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFSMIG---NKLTKQISFK 400
            ..:...::|.|: |..|||:.|...|.|.|:.|:..||..|.|.||||.  |   .||.|:|||.
plant   339 CLDQFTAKEWLQGDNLYKCDRCDDYVKACKRLSIRCAPNILTIALKRFQ--GGRFGKLNKRISFP 401

  Fly   401 SRIDLSKYAARSQAAQAQPLTYRLVSMVTHLGA--SQHCGHYTAIGSTDTGSFYNFDDSYVRPIA 463
            ...||..|  .|...:...: |:|.:::.||..  :...|||........|::|..|||.|..:.
plant   402 ETFDLGPY--MSGGGEGSDV-YKLYAVIVHLDMLNASFFGHYICYVKDFRGNWYRIDDSEVEKVE 463

  Fly   464 MHSVCNTNAYIMFFELDLSQAASPAANRPNGVRLTNGHSTTPVPAATVSSPSPTRFIGPQLPAGG 528
            :..|.:..||::.:        |....||:.:|.....                           
plant   464 LEDVLSQRAYMLLY--------SRVQPRPSNLRSEESQ--------------------------- 493

  Fly   529 ANGYTNGNAQKTAIQFKQQNQQSPQNGLQLGTGKFQDTAKPPLVGAHAKGEATSAPTANGNKSSS 593
                   :.:||.....:.||........:||   .||:    |.:...|..:.:......|.||
plant   494 -------DEKKTDTLNTESNQDGSVESSGVGT---NDTS----VSSLCNGIISHSEDPEYEKESS 544

  Fly   594 PSSN-----------------SSSNHKSINQQQYLPISSDDEDIEDEMKPRPTTAQLPSMPNMTE 641
            .|::                 .|.:::||:.:.  ...:|.::.|...|..||...|        
plant   545 LSASVPVSEEGKEVDVKVDTVDSESNRSIDMEH--DSGTDHQEEEANGKEDPTVENL-------- 599

  Fly   642 NHTEPKAKSPVKIQVKTPVKTPLKSLVPYES-ASEEEEAPLPNPRKRPSGEDSSESDQESGQTNG 705
                  |.....:.:.||..:.....:|.|: .|:.|..||               ::|...|..
plant   600 ------AVDSSCLDITTPSPSAATEFIPQENERSDTESKPL---------------EKEHSDTES 643

  Fly   706 HSKTNGSHTNGSASSSVHVNNSKQKTDAID 735
            :......|.:   |.|..:......|:.||
plant   644 NKPLEKEHLD---SESKPLEKEHSDTEMID 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 103/312 (33%)
UCH 172..477 CDD:278850 103/311 (33%)
Asp-B-Hydro_N <617..>731 CDD:191249 19/114 (17%)
UBP19NP_565576.1 zf-MYND 64..101 CDD:280009
Peptidase_C19E 173..478 CDD:239126 103/321 (32%)
UCH 173..477 CDD:278850 103/312 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 179 1.000 Domainoid score I1057
eggNOG 1 0.900 - - E1_KOG1865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000177
OrthoInspector 1 1.000 - - otm2471
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1006
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.