DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and USP17L28

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_001229260.1 Gene:USP17L28 / 728400 HGNCID:44456 Length:530 Species:Homo sapiens


Alignment Length:511 Identity:145/511 - (28%)
Similarity:230/511 - (45%) Gaps:71/511 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 NELPKPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAH 206
            ::|....|.|.|||.:.:   .|.|...||.|:.|:|||||:|::||.|.:.|.|||:::|.: |
Human    53 DDLAPVARQLAPREKLPL---SSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSRE-H 113

  Fly   207 LADCNVAEPGSGCIICAMTKTLLATQSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRFLVE 271
            ...|:   ...||::|.|...:.....|     |..:....:.:......|:||||||||.|.|:
Human   114 SQTCH---RHKGCMLCTMQAHITRALHN-----PGHVIQPSQALAAGFHRGKQEDAHEFLMFTVD 170

  Fly   272 AMERAYLMRFRNYKELDQLVKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADS 336
            ||::|.|   ..:|::|...|:||.:.||||||.||:::||.|:.:|.||..:.|:.|||:.|.|
Human   171 AMKKACL---PGHKQVDHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQS 232

  Fly   337 LEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFS-MIGNKLTKQISF 399
            ::.|.|.....|.|. :..|.|..|.::..|:|..:|..:...|.:.||||| :.|||:.|.:.:
Human   233 VQQALEQLVKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKIAKNVQY 297

  Fly   400 KSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTDTGSFYNFDDSYVRPIAM 464
            ...:|:..|.::....   ||.|.|.:::.|.|.|.|.|||.:......|.:|..||:.|...::
Human   298 PECLDMQPYMSQPNTG---PLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSI 359

  Fly   465 HSVCNTNAYIMFF----ELDLSQAASPAANRPNGV-------RLTNGHSTTPVPAATVSSPSPTR 518
            .||.:..||::|:    |.:....:......|..:       |.|.|......|..         
Human   360 TSVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRRATQGELKRDHPCL--------- 415

  Fly   519 FIGPQLPAGGANGYTNGNAQKTAIQFK---QQNQQSPQNGLQLGTGKFQDTAKPPLVGAHAKGEA 580
                |.|....:.......:.|...:|   :||:..|:..::    |.:.|..|.::..|     
Human   416 ----QAPELDEHLVERATQESTLDHWKFLQEQNKTKPEFNVR----KVEGTLPPDVLVIH----- 467

  Fly   581 TSAPTANGNKSSSPSSNSSSNHKSINQQQYLPISSDDEDIEDEMKPRPTTAQLPSM 636
                       .|.......||....|...|.:||.....::.|    .|..|.|:
Human   468 -----------QSKYKCGMKNHHPEQQSSLLNLSSSTPTHQESM----NTGTLASL 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 107/307 (35%)
UCH 172..477 CDD:278850 106/306 (35%)
Asp-B-Hydro_N <617..>731 CDD:191249 4/20 (20%)
USP17L28NP_001229260.1 Peptidase_C19E 79..373 CDD:239126 108/308 (35%)
UCH 80..372 CDD:278850 106/306 (35%)
HABP4_PAI-RBP1 <426..454 CDD:282609 5/31 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 205 1.000 Domainoid score I2923
eggNOG 1 0.900 - - E1_KOG1865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000177
OrthoInspector 1 1.000 - - otm42310
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.