DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and USP17L1

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_001243802.1 Gene:USP17L1 / 401447 HGNCID:37182 Length:530 Species:Homo sapiens


Alignment Length:527 Identity:145/527 - (27%)
Similarity:225/527 - (42%) Gaps:95/527 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 NELPKPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAH 206
            ::|....|.|.|||.:.:   .|.|...||.|:.|:|||||.|::||.|.:...|||:::|.: |
Human    53 DDLAPVARQLAPREKLPL---SSRRPAAVGAGLQNMGNTCYENASLQCLTYTLPLANYMLSRE-H 113

  Fly   207 LADCNVAEPGSGCIICAMTKTLL-ATQSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRFLV 270
            ...|   :....|::|.|...:. |..|....::|    |:......|.  |:|||.||||.|.|
Human   114 SQTC---QRPKCCMLCTMQAHITWALHSPGHVIQP----SQALAAGFHR--GKQEDVHEFLMFTV 169

  Fly   271 EAMERAYLMRFRNYKELDQLVKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKAD 335
            :||::|.|   ..:|::|...|:||.:.|||||..||:::||.|:.:|.||..:.|:.|||:.|.
Human   170 DAMKKACL---PGHKQVDHHCKDTTLIHQIFGGCWRSQIKCLHCHGISDTFDPYLDIALDIQAAQ 231

  Fly   336 SLEDAFEGHFSRERLE-DMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFS-MIGNKLTKQIS 398
            |::.|.|.....|.|. :..|.|..|.::..|:...:|..:...|.:.||||| :.||||.|.:.
Human   232 SVKQALEQLVKPEELNGENAYHCGLCLQRAPASNTLTLHTSAKVLILVLKRFSDVAGNKLAKNVQ 296

  Fly   399 FKSRIDLSKYAARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTDTGSFYNFDDSYVRPIA 463
            :...:|:..|.::....   ||.|.|.:::.|.|.|.|.|||.:........:|..||:.|...:
Human   297 YPECLDMQPYMSQQNTG---PLVYVLYAVLVHAGWSCHDGHYFSYVKAQEVQWYKMDDAEVTVCS 358

  Fly   464 MHSVCNTNAYIMFF---------ELDLSQAASPAA-------NRPNGVRLTNGHSTTPVP----- 507
            :.||.:..||::|:         ...:|:...|.|       .|.....|...|.....|     
Human   359 IISVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGAEDTDRRAKQGELKRDHPCLQAPELDEH 423

  Fly   508 ----AATVSSPSPTRFIGPQLPAGGANGYTNGNAQKTAIQFKQQNQQSPQNGLQLGTGKFQDTAK 568
                |...|:....:|:                        ::||:..|    :...||.:.|..
Human   424 LVERATQESTLDHWKFL------------------------QEQNKTKP----EFNVGKVEGTLP 460

  Fly   569 PPLVGAHAKGEATSAPTANGNKSSSPSSNSSSNHKSINQQQYLPISSDDEDIEDEMKPRPTTAQL 633
            |..:..|                .|.......||....|...|.:||.....::.|    .|..|
Human   461 PNALVIH----------------QSKYKCGMKNHHPEQQSSLLNLSSTTRTDQESM----NTGTL 505

  Fly   634 PSMPNMT 640
            .|:...|
Human   506 ASLQGRT 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 105/308 (34%)
UCH 172..477 CDD:278850 104/307 (34%)
Asp-B-Hydro_N <617..>731 CDD:191249 5/24 (21%)
USP17L1NP_001243802.1 Peptidase_C19E 79..373 CDD:239126 106/309 (34%)
UCH 80..372 CDD:278850 104/307 (34%)
HABP4_PAI-RBP1 <426..454 CDD:282609 6/55 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 205 1.000 Domainoid score I2923
eggNOG 1 0.900 - - E1_KOG1865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000177
OrthoInspector 1 1.000 - - otm42310
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24006
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.