DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and Usp49

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_001129942.1 Gene:Usp49 / 316211 RGDID:1310513 Length:685 Species:Rattus norvegicus


Alignment Length:431 Identity:105/431 - (24%)
Similarity:161/431 - (37%) Gaps:116/431 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 KPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHI----------------- 193
            ||:|.|.....:              ||:.|:|||||:||.||.|.|:                 
  Rat   238 KPRRQLAVAPGV--------------TGLRNLGNTCYMNSILQVLSHLQKFRECFLNLDPSTSEH 288

  Fly   194 --PALANWLVSEQAHLADCNVA------------EPGSGCII--CAMTKTLLATQSNQSAVRPFL 242
              |...|......:..|....|            ||...|..  .:::::|...|:.:.:.:...
  Rat   289 LFPQATNGKAQIPSRPASSTAAGFSVRSDRAQGFEPQGFCWSSGASISRSLELIQNKEPSSKHIS 353

  Fly   243 IYSKLKQICKHMVVGR------------------------QEDAHEFLRFLV---------EAME 274
            :..:|..:.:.|..|:                        |:||.|||..|:         |...
  Rat   354 LCHELHTLFRVMWSGKWALVSPFAMLHSVWSLIPAFRGYDQQDAQEFLCELLHKVQQELESEGST 418

  Fly   275 RAYLMRFRNYKELDQLVKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLD--------- 330
            |..|:.|...|...|::|   .:..||.|.|.|:|.|:|||:.|.|.:.|.||.|:         
  Rat   419 RRILIPFSQRKLTKQVLK---VVNTIFHGQLLSQVTCVSCNYKSNTIEPFWDLSLEFPERYHCVE 480

  Fly   331 -----IRKADSLEDAFEGHFSR-ERLEDMGYKCEGCKKK-----------VSATKQFSLERAPIT 378
                 :.:.:.|.......|:. |.||...|.|:.|..|           ..|.||..:.|.|..
  Rat   481 KGFVPLNQTECLLTEMLAKFTETEALEGRIYACDQCNSKRRKSNPKPLVLSEARKQLMIYRLPQV 545

  Fly   379 LCIQLKRFSMIG----NKLTKQISFKSRIDLSKYAARSQAAQAQPLT--YRLVSMVTHLGASQHC 437
            |.:.||||...|    .|:...:.|...:.:..|......:.....|  |.|.::|.|.|.....
  Rat   546 LRLHLKRFRWSGRNHREKIGVHVVFDQVLTMEPYCCGDMLSSLDKDTFAYDLSAVVMHHGKGFGS 610

  Fly   438 GHYTA-IGSTDTGSFYNFDDSYVRPIAMHSVCNTNAYIMFF 477
            ||||| ..:|:.|.:.:.:||.:...::..||.|.|||:|:
  Rat   611 GHYTAYCYNTEGGFWVHCNDSKLDVCSVEEVCKTQAYILFY 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 100/404 (25%)
UCH 172..477 CDD:278850 100/403 (25%)
Asp-B-Hydro_N <617..>731 CDD:191249
Usp49NP_001129942.1 zf-UBP 26..87 CDD:396634
UCH 250..651 CDD:395355 100/403 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.