DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and ubp8

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_592992.1 Gene:ubp8 / 2542135 PomBaseID:SPAC13A11.04c Length:449 Species:Schizosaccharomyces pombe


Alignment Length:470 Identity:110/470 - (23%)
Similarity:198/470 - (42%) Gaps:101/470 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 KIEYEEVPNYHESVLENLKSKYIVIKPGNPGAINGFSGK----NNTGKLVGANGHDNNGARKQAE 120
            |::..:|.||.:...:.....::..:......||..|.:    ::.|.|.|.:|.         |
pombe    12 KLKPADVENYQKICTQIFSCHFVPRRCSTCKRINKRSIRCLSCHSVGCLWGHHGE---------E 67

  Fly   121 HPNNQSHHI-----NHHNHQHPTSNPNELPKPKRVLYPRENIRIGWK----------------QS 164
            |....:|.|     |.|.:.....:.....:.:.:.:..:||: .|:                ::
pombe    68 HAMEHTHMIGVDVKNGHTYCFGCQDYVYQTELETLRFKIKNIK-AWQSDHKRLPEKYNQMVCLEA 131

  Fly   165 ERKW-----QVG-TGMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLADCNVAEPGSGCIICA 223
            .||:     ..| .|:.|:|.||:::..||::||.|.:.|...|......||.  .|  .|:.||
pombe   132 YRKYPPVCATAGLRGIQNLGATCFMSVILQSILHNPLVRNLFFSGFHTSTDCK--RP--TCMTCA 192

  Fly   224 ---MTKTLLATQSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRNYK 285
               |..::..:::..:...|..:.:.:.::.|.:....|:|.|||..:|                
pombe   193 IDDMFSSIYNSKNKSTFYGPTAVLNLMWKLSKSLCGYSQQDGHEFFVYL---------------- 241

  Fly   286 ELDQLVKE---------TTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSLEDAF 341
             |||:..|         |.|:.:||.|.|::.|.||.|....:......|:.|||.: .:|:...
pombe   242 -LDQMHTESGGGTSMPCTCPIHRIFSGSLKNVVTCLDCKKERVAVDPLMDISLDINE-PTLQGCL 304

  Fly   342 EGHFSRERLEDMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFSM----IGNKLTKQISFKSR 402
            |...|:|:::   |.|..|..| :|.||...::.|.|:|:|||||..    :..|:.||:|:.:.
pombe   305 ERFVSKEKVQ---YSCHSCGSK-NAIKQLVFDKLPPTICMQLKRFEQNNFAMSTKIDKQVSYPAF 365

  Fly   403 IDLSKYAARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTDTGSFYN-----FDDSYVRPI 462
            :.: :|....     ..:.|:|.|:|.|.| :...|||.|.      ::|.     .||:.:..:
pombe   366 LRM-RYNFNQ-----DDVDYQLYSVVCHKG-TLDTGHYIAY------TYYQNQWFLLDDTTIVEV 417

  Fly   463 AMHSVCNTNAYIMFF 477
            ....|.|:.||::|:
pombe   418 KESEVLNSQAYLLFY 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 87/327 (27%)
UCH 172..477 CDD:278850 86/325 (26%)
Asp-B-Hydro_N <617..>731 CDD:191249
ubp8NP_592992.1 ZnF_UBP 37..85 CDD:197632 12/56 (21%)
UCH 144..432 CDD:278850 86/326 (26%)
Peptidase_C19D 145..433 CDD:239125 87/327 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.