DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and ubp3

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_596528.1 Gene:ubp3 / 2541378 PomBaseID:SPBP8B7.21 Length:512 Species:Schizosaccharomyces pombe


Alignment Length:459 Identity:111/459 - (24%)
Similarity:177/459 - (38%) Gaps:127/459 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ARK--QAEHPNNQSHHI----NHHNHQHPTSNPNEL----------PKPKRVLYPRENIRIGWKQ 163
            |:|  |.:.|..:||.:    :....:...|:..||          |:|   :.||         
pombe    81 AKKHVQGDSPVKKSHSVPVPSDRSEKKSFNSSLGELIETYSPSLDAPRP---IQPR--------- 133

  Fly   164 SERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLADCNVAEPGSGCIICAMTKTL 228
                     |.||.||.|::||.||||::.....| |:.:...:...|. |..:..|   .:.|:
pombe   134 ---------GFINTGNICFMNSILQALMYCVPFYN-LLKQINRMVPYNF-ERTTPLI---ESLTM 184

  Fly   229 LATQSNQ---------SAVRPFLIYSKLK--QICKHMVVGRQEDAHEFLRFLVEAMERAYLMRFR 282
            |:....:         .::.|.::||..|  ...:.:..|.||||.|||...::.:...::...|
pombe   185 LSRDFREYSEKFDLQGDSILPEVVYSATKGNPRFEMLQTGEQEDAEEFLNLFLDELHEEFVRERR 249

  Fly   283 NY--------------------KELDQL--------------------------VKETTPLGQIF 301
            :|                    ..||..                          ..|.:|:.|||
pombe   250 HYLLKNDERNPKSDIKISNGIKSGLDSFDDQSSVEASGWTEVGKNKKPVIARSATVERSPISQIF 314

  Fly   302 GGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKAD--SLEDAFEGHFSRERLEDMGYKCEGCKKKV 364
            ||.|||.:|..|... |:..:.||.|.|||:..|  |:.||.|...:.|.|.:.    ...|..|
pombe   315 GGQLRSTLRVPSARD-SVLLEPFQPLQLDIQAEDIHSVIDALEHMTAPEILPEW----HSSKGNV 374

  Fly   365 SATKQFSLERAPITLCIQLKRF----SMIGNKLTKQISFKSRIDLSKYAARSQAAQAQPLTYRLV 425
            :||||..:|..|..|.:.||||    |....|..|.|::.:|:.:.:.........:....|.|.
pombe   375 TATKQMYIESLPPVLILHLKRFFYEASGGTQKNYKPIAYPARLSIPQNVFSPSVRGSIHPEYDLN 439

  Fly   426 SMVTHLGASQHCGHYTA-IGSTDTGSFYNFDDSYVRPIAMHSVCNTN----------------AY 473
            ::|.|.|.|...||||. :...|...::..||:::..:.:|.|.|:.                ||
pombe   440 AVVYHHGTSASGGHYTVDVQQLDKSGWFRIDDTHIHRVPIHDVENSELSADPSLSKLGHGDRVAY 504

  Fly   474 IMFF 477
            ::|:
pombe   505 LLFY 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 97/385 (25%)
UCH 172..477 CDD:278850 97/384 (25%)
Asp-B-Hydro_N <617..>731 CDD:191249
ubp3NP_596528.1 UCH 132..508 CDD:278850 99/403 (25%)
Peptidase_C19 134..508 CDD:239072 97/383 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.