DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and ubp4

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_001342719.1 Gene:ubp4 / 2540837 PomBaseID:SPBC18H10.08c Length:593 Species:Schizosaccharomyces pombe


Alignment Length:403 Identity:99/403 - (24%)
Similarity:161/403 - (39%) Gaps:106/403 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 ELPKPKRVLYPRENIRIGWKQSERKWQVGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAHL 207
            ||..||:|         ....|...:| ..|:.|:|||||:|..||.|.....|...::..:..|
pombe   208 ELANPKKV---------DSSLSYENYQ-PIGLTNLGNTCYMNCVLQCLFACKDLTIPMLQGRGLL 262

  Fly   208 ADCNVAEP-GSGCIICAMTKTLLAT---QSNQSAVRPFLIYSKLKQICKHMVVGRQEDAHEFLRF 268
            .:.|...| |:|..|.:...:||.:   ...|.::.|......::.:.:...:..|.||.|||.|
pombe   263 QNINTKNPLGTGGKITSAFFSLLQSVLLNHGQRSISPRNFLEIVQSLNRDFSIDGQCDAQEFLNF 327

  Fly   269 LVEAMERAYLMRFRNYKEL--------------DQL-VKETTPLGQI------------------ 300
            .::.:          :::|              ||| .:|..||...                  
pombe   328 FLDKL----------HEDLNSNASRSPIAPLTEDQLSAREELPLSHFSHIEWNLHLRSNKSIVVN 382

  Fly   301 -FGGYLRSEVRCLSCNHVSITFQHFQDLLL---DIRKADSLEDAFEGHFSRERLEDM-GYKCEGC 360
             |.|.|.|..:|::|...|.||..|..|.:   |:....||::......:.|.|:.. |:.|..|
pombe   383 NFVGQLCSRTQCMTCGRTSTTFAPFTSLAIPIDDVSHVVSLQECLLKFSAPELLQGHDGWHCPVC 447

  Fly   361 KKKVSATKQFSLERAPITLCIQLKRF--SMIGNK-------LTKQI--------SFKSRIDLSKY 408
            |.:.||.|...:.:.|..|.||::||  |::|.|       |:.||        ||:|.|...  
pombe   448 KVQRSAKKVIMISKLPEYLIIQIQRFKISVMGRKKIDTPLGLSLQIPSKMLVPPSFQSGIGYI-- 510

  Fly   409 AARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTD---TGSFYNFDDSYVRPIAMHSVCN- 469
                      |..|.|.:.:.|.|..:: |||.    :|   ...:.:.|||.||.:.  .:.: 
pombe   511 ----------PSNYNLFAFICHYGQLEN-GHYI----SDVLFNNEWCHIDDSIVRTVG--GITDL 558

  Fly   470 ----TNAYIMFFE 478
                :::||:|::
pombe   559 REDFSSSYILFYK 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 91/372 (24%)
UCH 172..477 CDD:278850 91/371 (25%)
Asp-B-Hydro_N <617..>731 CDD:191249
ubp4NP_001342719.1 COG5533 156..574 CDD:227820 99/403 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.