DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scny and usp-3

DIOPT Version :9

Sequence 1:NP_729092.1 Gene:scny / 38648 FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_493434.3 Gene:usp-3 / 190579 WormBaseID:WBGene00013506 Length:550 Species:Caenorhabditis elegans


Alignment Length:328 Identity:102/328 - (31%)
Similarity:159/328 - (48%) Gaps:38/328 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 GMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLADC--NVAEPGSGCIICAMT---KTLLATQ 232
            ||.||||||::|:.||||..|.....:::| .:.|.|.  :..||.:|...|.:|   :.||.:|
 Worm   230 GMRNVGNTCFMNAVLQALASISEFREYIMS-LSSLEDYIHDEKEPKNGGNYCYLTDEYRKLLISQ 293

  Fly   233 SNQSAVRP---------FLIYSKLKQICKHMVVGRQEDAHEFLRFLVEAMERAYLMRFRNYKELD 288
            |.:|...|         |:      .:|......||.|:|||:|:.::::.    ...|..::|.
 Worm   294 SARSFREPTAPNEFREAFI------SVCPRFRGFRQHDSHEFMRYFMDSLH----TEMRKCRKLP 348

  Fly   289 QLVKET-TPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDI---RKADS--LEDAFEGHFSR 347
            .:..:. ||:.:.|.|.|:|.|.|.:|.:.|.....|.||.|||   |.|..  |.|.....|..
 Worm   349 GMPDDKHTPISKYFEGTLQSSVICQTCRNCSNKIDEFMDLSLDIPAQRNASKVRLSDCLSTFFKL 413

  Fly   348 ERLEDMGYK--CEGCKKKVSATKQFSLERAPITLCIQLKRFSMIGNKLTKQISF-KSRIDLSKYA 409
            |.|| .|.|  |..||.|.:.:||..:.:.|..||:.:|||...|.|....|.| ..::|::::.
 Worm   414 EMLE-KGEKPECAKCKTKQTCSKQMFIRKLPQVLCLHMKRFRDNGGKNDAIIDFPMGQLDVTQFL 477

  Fly   410 ARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTDTGSFYNFDDSYVRPIAMHSVCNTNAYI 474
              :..:...|.||.|.|::.|:|.....|||.|.|..: |.::.|||:.|:.:....|....||:
 Worm   478 --TDDSDEAPCTYSLQSIIVHIGYGCGSGHYIAFGKRN-GRWFQFDDTVVKGVDEAHVSKQKAYV 539

  Fly   475 MFF 477
            :.:
 Worm   540 LLY 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 102/326 (31%)
UCH 172..477 CDD:278850 102/326 (31%)
Asp-B-Hydro_N <617..>731 CDD:191249
usp-3NP_493434.3 zf-UBP 53..111 CDD:366940
UCH 229..542 CDD:366104 102/326 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.