DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppat-Dpck and CAB4

DIOPT Version :9

Sequence 1:NP_647985.1 Gene:Ppat-Dpck / 38647 FlyBaseID:FBgn0035632 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_011793.3 Gene:CAB4 / 853194 SGDID:S000003509 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:186 Identity:60/186 - (32%)
Similarity:99/186 - (53%) Gaps:7/186 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LDDSVISDLSAQQDDTQPPKVYPSVVLGGTFDRIHLGHKIFLTQAVLRTCKRLVVGVTTSAMTKG 187
            |.|:::.::...:|..:    :....||||||.||.||||.|:.:...|.:||:.|:|...:.:.
Yeast   125 LHDNIMEEIEGPKDANK----FHVTALGGTFDHIHDGHKILLSVSTFITSQRLICGITCDELLQN 185

  Fly   188 KTLPDLILPVEERIARLREFLVDIDDTLQYEIVPIDDPFGPTQVDPDLDMIVVSAETLRGGQKVN 252
            |...:||.|.:.|...:.:|:..:...|..|:||:.|..|||...|:::.:|||.||:.|.:.||
Yeast   186 KKYKELIEPYDTRCRHVHQFIKLLKPDLSVELVPLRDVCGPTGKVPEIECLVVSRETVSGAETVN 250

  Fly   253 EVRSAKQLRELEIFVIDIVESNVHDGIHETKVSSSNTRIDLLGTRWRRPEPRPQLP 308
            :.|..|.:..|.:.|::::.....||..| |:||:..|..|..:  ..|...||.|
Yeast   251 KTRIEKGMSPLAVHVVNVLGGREEDGWSE-KLSSTEIRRLLKSS--ASPTCTPQNP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppat-DpckNP_647985.1 PPAT_CoAS 147..290 CDD:173915 51/142 (36%)
CoaE 311..510 CDD:223315
DPCK 313..494 CDD:238980
CAB4NP_011793.3 PPAT_CoAS 144..288 CDD:173915 51/144 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 97 1.000 Domainoid score I1625
eggNOG 1 0.900 - - E1_COG1019
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2476
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005202
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101466
Panther 1 1.100 - - LDO PTHR10695
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4246
SonicParanoid 1 1.000 - - X3717
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.