Sequence 1: | NP_647985.1 | Gene: | Ppat-Dpck / 38647 | FlyBaseID: | FBgn0035632 | Length: | 518 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001122103.1 | Gene: | DCAKD / 79877 | HGNCID: | 26238 | Length: | 231 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 61/196 - (31%) |
---|---|---|---|
Similarity: | 103/196 - (52%) | Gaps: | 17/196 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 312 YIIGLTGGIASGKSKMGERLANMGAHVIDCDKVAHDVYEPGQLCYTRIVQHFGQGIVSDDGRIDR 376
Fly 377 SKLGPLVFADPKQLQALNGIVWPELIAEVNRRLDA--LRSQADVPRVVVLEAAVLLRAGWETN-- 437
Fly 438 ----CHEVWSMIVPPDEAVRRIIERNKLSEVEAQKRLASQVPNSEIVAKSHVIFSSQWDHEFTQK 498
Fly 499 Q 499 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ppat-Dpck | NP_647985.1 | PPAT_CoAS | 147..290 | CDD:173915 | |
CoaE | 311..510 | CDD:223315 | 61/196 (31%) | ||
DPCK | 313..494 | CDD:238980 | 59/188 (31%) | ||
DCAKD | NP_001122103.1 | coaE | 1..196 | CDD:234620 | 61/196 (31%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0237 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |