DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ppat-Dpck and Dcakd

DIOPT Version :9

Sequence 1:NP_647985.1 Gene:Ppat-Dpck / 38647 FlyBaseID:FBgn0035632 Length:518 Species:Drosophila melanogaster
Sequence 2:NP_080827.2 Gene:Dcakd / 68087 MGIID:1915337 Length:231 Species:Mus musculus


Alignment Length:215 Identity:67/215 - (31%)
Similarity:111/215 - (51%) Gaps:24/215 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 YIIGLTGGIASGKSKMGERLANMGAHVIDCDKVAHDVYEPGQLCYTRIVQHFGQGIVSDDGRIDR 376
            :::|||||||||||.:.:....:|..|||.|.:|..|.:||...:.|||:.||..::.::|.|||
Mouse     2 FLVGLTGGIASGKSSVIQVFQQLGCAVIDVDVIARHVVQPGYPAHRRIVEAFGTEVLLENGDIDR 66

  Fly   377 SKLGPLVFADPKQLQALNGIVWPELIAEVNRRLDA--LRSQADVPRVVVLEAAVLLRAGWETN-- 437
            ..||.|:|..|.:.|.||.|..||:..|:.:....  ||..    |.|:|:..:|    :||.  
Mouse    67 KVLGDLIFNQPDRRQLLNSITHPEIRKEMMKETFKYFLRGY----RYVILDIPLL----FETKKL 123

  Fly   438 ----CHEVWSMIVPPDEAVRRIIERNKLSEVEAQKRLASQVPNSEIVAKSHVIFSSQWDHEFTQK 498
                .|.| .:....|..:.|:::||.|:..:|:.|:.:|:|..:....::.:..:..:...|::
Mouse   124 LKYMKHTV-VVYCDRDTQLARLMKRNNLNREDAEARINAQLPLKDKARMANHVLDNSGEWSLTRR 187

  Fly   499 QA-------ERAWKMLTKEL 511
            ||       ||:.:.|...|
Mouse   188 QAILLHAKLERSMEYLPLRL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ppat-DpckNP_647985.1 PPAT_CoAS 147..290 CDD:173915
CoaE 311..510 CDD:223315 66/212 (31%)
DPCK 313..494 CDD:238980 60/188 (32%)
DcakdNP_080827.2 coaE 1..196 CDD:234620 63/202 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0237
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.