DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Txl and TRX3

DIOPT Version :10

Sequence 1:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_010006.1 Gene:TRX3 / 850444 SGDID:S000000679 Length:127 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:32/81 - (39%)
Similarity:47/81 - (58%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VVVDFTASWCGPCKRIAPIFETFPTKYPKAIFLKVDVDKCQDTAAGQGVSAMPTFIFYRNRTKID 88
            :|:||.|:||||||.:.|........||...|:|.|||:..|.|....|:|||||:..::...|.
Yeast    46 LVIDFYATWCGPCKMMQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIG 110

  Fly    89 RVQGADVNGLEAKIQE 104
            ::.||:...||..|::
Yeast   111 KIIGANPTALEKGIKD 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TxlNP_523938.2 TRX_family 10..103 CDD:239245 31/78 (40%)
PITH 125..266 CDD:461848
TRX3NP_010006.1 TRX_family 35..125 CDD:239245 31/78 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.