DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Txl and THM1

DIOPT Version :10

Sequence 1:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_849585.1 Gene:THM1 / 839436 AraportID:AT1G03680 Length:179 Species:Arabidopsis thaliana


Alignment Length:92 Identity:34/92 - (36%)
Similarity:49/92 - (53%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VRVINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYPKAI-FLKVDVDKCQDT 66
            :.|:|| |.:.:.:.:|. :.|.|||.|.||||||.|.||......||.... |.|::.|:...|
plant    76 IPVVND-STWDSLVLKAD-EPVFVDFWAPWCGPCKMIDPIVNELAQKYAGQFKFYKLNTDESPAT 138

  Fly    67 AAGQGVSAMPTFIFYRNRTKIDRVQGA 93
            ....||.::||.:.:.|..|.|.:.||
plant   139 PGQYGVRSIPTIMIFVNGEKKDTIIGA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TxlNP_523938.2 TRX_family 10..103 CDD:239245 31/85 (36%)
PITH 125..266 CDD:461848
THM1NP_849585.1 CnoX 79..179 CDD:442352 33/89 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.