DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Txl and ATHM2

DIOPT Version :10

Sequence 1:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_192261.1 Gene:ATHM2 / 825653 AraportID:AT4G03520 Length:186 Species:Arabidopsis thaliana


Alignment Length:92 Identity:33/92 - (35%)
Similarity:47/92 - (51%) Gaps:3/92 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VRVINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYP-KAIFLKVDVDKCQDT 66
            ::|:||.:.....|...|  .|||||.|.||||||.|.|:.......|. |..|.|::.|:..:|
plant    82 IQVVNDSTWDSLVLKATG--PVVVDFWAPWCGPCKMIDPLVNDLAQHYTGKIKFYKLNTDESPNT 144

  Fly    67 AAGQGVSAMPTFIFYRNRTKIDRVQGA 93
            ....||.::||.:.:....|.|.:.||
plant   145 PGQYGVRSIPTIMIFVGGEKKDTIIGA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TxlNP_523938.2 TRX_family 10..103 CDD:239245 30/85 (35%)
PITH 125..266 CDD:461848
ATHM2NP_192261.1 CnoX 82..185 CDD:442352 33/92 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.