DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Txl and TRX-M4

DIOPT Version :10

Sequence 1:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_188155.1 Gene:TRX-M4 / 820775 AraportID:AT3G15360 Length:193 Species:Arabidopsis thaliana


Alignment Length:94 Identity:31/94 - (32%)
Similarity:54/94 - (57%) Gaps:3/94 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVRVIN-DESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYP-KAIFLKVDVDKCQ 64
            :|.|.| .:|.:|.::.::.:. |:|:|.|.|||||:.|.||.:.....:. |..|.|::.|:..
plant    85 AVEVPNLSDSEWQTKVLESDVP-VLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESP 148

  Fly    65 DTAAGQGVSAMPTFIFYRNRTKIDRVQGA 93
            :||...|:.::||.|.::...|.|.:.||
plant   149 NTANRYGIRSVPTVIIFKGGEKKDSIIGA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TxlNP_523938.2 TRX_family 10..103 CDD:239245 28/85 (33%)
PITH 125..266 CDD:461848
TRX-M4NP_188155.1 CnoX 90..191 CDD:442352 29/89 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.