DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Txl and dhd

DIOPT Version :10

Sequence 1:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_511046.1 Gene:dhd / 31444 FlyBaseID:FBgn0011761 Length:107 Species:Drosophila melanogaster


Alignment Length:98 Identity:38/98 - (38%)
Similarity:57/98 - (58%) Gaps:4/98 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SVRVINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKY-PKAIFLKVDVDKCQD 65
            |||.:||   :...:..|..:|:|:||.|:||||||.:....::...|| .||:.||:||||.::
  Fly     3 SVRTMND---YHKRIEAADDKLIVLDFYATWCGPCKEMESTVKSLARKYSSKAVVLKIDVDKFEE 64

  Fly    66 TAAGQGVSAMPTFIFYRNRTKIDRVQGADVNGL 98
            ......|.:||||:|.|...::....|||.:.|
  Fly    65 LTERYKVRSMPTFVFLRQNRRLASFAGADEHKL 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TxlNP_523938.2 TRX_family 10..103 CDD:239245 33/90 (37%)
PITH 125..266 CDD:461848
dhdNP_511046.1 CnoX 6..105 CDD:442352 35/95 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.