DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Txl and Txn1

DIOPT Version :10

Sequence 1:NP_523938.2 Gene:Txl / 38646 FlyBaseID:FBgn0035631 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_446252.1 Gene:Txn1 / 116484 RGDID:621157 Length:105 Species:Rattus norvegicus


Alignment Length:102 Identity:52/102 - (50%)
Similarity:64/102 - (62%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VRVINDESHFQAELAQAGIQLVVVDFTASWCGPCKRIAPIFETFPTKYPKAIFLKVDVDKCQDTA 67
            |::|..:..||..||.||.:||||||:|:||||||.|.|.|.:...||...:||:||||.|||.|
  Rat     2 VKLIESKEAFQEALAAAGDKLVVVDFSATWCGPCKMIKPFFHSLCDKYSNVVFLEVDVDDCQDVA 66

  Fly    68 AGQGVSAMPTFIFYRNRTKIDRVQGADVNGLEAKIQE 104
            |...|..||||.||:...|:....||:...|||.|.|
  Rat    67 ADCEVKCMPTFQFYKKGQKVGEFSGANKEKLEATITE 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TxlNP_523938.2 TRX_family 10..103 CDD:239245 48/92 (52%)
PITH 125..266 CDD:461848
Txn1NP_446252.1 Thioredoxin 2..103 CDD:395038 51/100 (51%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.