DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and MAP2

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_009462.2 Gene:MAP2 / 852187 SGDID:S000000187 Length:421 Species:Saccharomyces cerevisiae


Alignment Length:346 Identity:94/346 - (27%)
Similarity:158/346 - (45%) Gaps:53/346 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EPEKTIAEDLVVTKY----KLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEETG--KVYK 65
            |..:.:..||...::    :...||..:..:|:....|....:.:|....:|...:.||  .:..
Yeast    87 EESRYLKRDLERAEHWNDVRKGAEIHRRVRRAIKDRIVPGMKLMDIADMIENTTRKYTGAENLLA 151

  Fly    66 KEKDLKKGIAFPTCLSVNNCVCHFSPAKNDADYT-LKAGDVVKIDLGAHIDGFIAVAAHTIVVGA 129
            .|....:||.|||.||:|:|..||:|  |..|.| ||..||:|:|.|..::|.|..:|.|:    
Yeast   152 MEDPKSQGIGFPTGLSLNHCAAHFTP--NAGDKTVLKYEDVMKVDYGVQVNGNIIDSAFTV---- 210

  Fly   130 AADQKISGRQADVILAAYWAVQAA---LRLLKSGANNYSLTDAVQQISES---------YKCKPI 182
            :.|.:.....|.|..|.|..::.|   :||...|       :|:|::.||         |:.||.
Yeast   211 SFDPQYDNLLAAVKDATYTGIKEAGIDVRLTDIG-------EAIQEVMESYEVEINGETYQVKPC 268

  Fly   183 EGMLSHELKQFKIDGEKT--IIQNPSEAQRKEHEKCTFETYEVYAIDVIVSTGEG---VGREKDT 242
            ..:..|.:..::|.|.|:  |::|....:.:|.|.        :||:...|||.|   .|.|   
Yeast   269 RNLCGHSIAPYRIHGGKSVPIVKNGDTTKMEEGEH--------FAIETFGSTGRGYVTAGGE--- 322

  Fly   243 KVSIYKKSEENY--MLKMKASRALLAEVKTKYGNMPFNIRSFEE--ETKARMGVVECVGHKMIEP 303
             ||.|.:|.|::  |..:.:::.||..:...:|.:||..|..:.  :.|....:...|.|.:::.
Yeast   323 -VSHYARSAEDHQVMPTLDSAKNLLKTIDRNFGTLPFCRRYLDRLGQEKYLFALNNLVRHGLVQD 386

  Fly   304 FQVLYEKPSEIVAQFKHTVLL 324
            :..|.:.|....|||:||:||
Yeast   387 YPPLNDIPGSYTAQFEHTILL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 94/346 (27%)
MAP2NP_009462.2 PTZ00053 <58..421 CDD:240246 94/346 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.