DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and MAP1

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_013345.1 Gene:MAP1 / 850945 SGDID:S000004234 Length:387 Species:Saccharomyces cerevisiae


Alignment Length:326 Identity:68/326 - (20%)
Similarity:115/326 - (35%) Gaps:108/326 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VNKTLKA-VIGLCVVD---ASVREICTQGDNQLTEETGKVYKKEKDLKKGIAFPT---------- 78
            :.|..|| ::|..|:|   |.||...|      |:|..::...| .:|:| |:|:          
Yeast   135 IKKIRKACMLGREVLDIAAAHVRPGIT------TDELDEIVHNE-TIKRG-AYPSPLNYYNFPKS 191

  Fly    79 -CLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGRQADV 142
             |.|||..:||..|.|.    .||.||:|.:|:..:..|:.|....|..||    :.||....:.
Yeast   192 LCTSVNEVICHGVPDKT----VLKEGDIVNLDVSLYYQGYHADLNETYYVG----ENISKEALNT 248

  Fly   143 ILAAYWAVQAALRLLKSGANNYSLTDAVQQISESYKCKPIEGMLSHELKQFKIDGEKTIIQNPSE 207
            ...:...::.|:::.|.|.....|.|.:::.:...||..:                         
Yeast   249 TETSRECLKLAIKMCKPGTTFQELGDHIEKHATENKCSVV------------------------- 288

  Fly   208 AQRKEHEKCTFETYEVYAIDVIVSTGEGVGR--EKDTKVSIYKKSEENYMLK---MKASRALLAE 267
                       .||          .|.|||.  .....:..|.|:....::|   :.....::.|
Yeast   289 -----------RTY----------CGHGVGEFFHCSPNIPHYAKNRTPGVMKPGMVFTIEPMINE 332

  Fly   268 VKTKYGNMPFNIRSFEEETKARMGVVECVGHKMIEPFQVLYEKPSEIVAQFKHTVLLMPNGVNLV 332
            ...|....|.:..|..::.|                          :.|||:||:|:..:||.::
Yeast   333 GTWKDMTWPDDWTSTTQDGK--------------------------LSAQFEHTLLVTEHGVEIL 371

  Fly   333 T 333
            |
Yeast   372 T 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 68/326 (21%)
MAP1NP_013345.1 PLN03158 23..379 CDD:215607 68/326 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.