DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and metap1d

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001019563.1 Gene:metap1d / 554090 ZFINID:ZDB-GENE-050522-71 Length:338 Species:Danio rerio


Alignment Length:267 Identity:61/267 - (22%)
Similarity:97/267 - (36%) Gaps:83/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FP--TCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGR 138
            ||  .|.||||.|||..|...    .|:.||::.||:..:::|:....:.|.::|:..||   ||
Zfish   150 FPKSVCTSVNNVVCHGIPDSR----PLQDGDIINIDVTVYLEGYHGDTSETFLIGSVNDQ---GR 207

  Fly   139 QADVILAAYWAVQAALRLLKSGANNYSLTDAVQQISES--YKCKPIEGMLSHELKQFKIDGEKTI 201
            :                          |.|..:|..:.  ..|.|.:.:.        :.|  .|
Zfish   208 K--------------------------LVDVARQCRDQAIAACGPGQPLC--------VIG--NI 236

  Fly   202 IQNPSEAQRKEHEKCTFETYEVYAIDVIVSTGEGVGREKDTKVSIYKKSEENYMLKMKASRALLA 266
            |.|  .|.......|.:            ..|.|:|........|:..:.:| .|||:...:...
Zfish   237 ISN--IANSNGFRVCPY------------FIGHGIGEYFHGHPEIWHHANDN-DLKMEEGMSFTI 286

  Fly   267 EVKTKYGNMPFNIRSFEEETKARMGVVECVGHKMIEPFQVLYEKPSEIVAQFKHTVLLMPNGVNL 331
            |.....|...|.|.| ::.|...:.                 :|.|   |||:|||::..:||.:
Zfish   287 EPILMEGTSGFRILS-DKWTAVSVD-----------------DKRS---AQFEHTVVITSDGVEI 330

  Fly   332 VTGIPFE 338
            :|.:|.|
Zfish   331 LTKLPEE 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 61/267 (23%)
metap1dNP_001019563.1 PRK12318 63..334 CDD:183434 59/262 (23%)
MetAP1 97..333 CDD:238519 58/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.