DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and metap1

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001020336.2 Gene:metap1 / 503783 ZFINID:ZDB-GENE-050626-124 Length:405 Species:Danio rerio


Alignment Length:273 Identity:54/273 - (19%)
Similarity:93/273 - (34%) Gaps:104/273 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FP--TCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGR 138
            ||  .|.|||..:||..|.:..    |:.||::.||:..:.:|:......|..||          
Zfish   207 FPKSCCTSVNEVICHGIPDRRH----LQEGDILNIDITVYHNGYHGDLNETFFVG---------- 257

  Fly   139 QADVILAAYWAVQAALRLLKSGANNYSLTDAVQQISESYKC--------KPIEGMLSHELKQFKI 195
            :.|         :.|.||:::                :|:|        ||  |:...||     
Zfish   258 EVD---------EGAKRLVQT----------------TYECLMQAIDSVKP--GIRYREL----- 290

  Fly   196 DGEKTIIQNPSEAQRKEHEKCTFETYEVYAIDVIVSTGEGVGREKDTKVSI--YKKSEENYMLKM 258
               ..|||..::|.       .|.....|.       |.|:.:...|..::  |.|::...::| 
Zfish   291 ---GNIIQKHAQAN-------GFSVVRSYC-------GHGIHKLFHTAPNVPHYAKNKAVGVMK- 337

  Fly   259 KASRALLAEVKTKYGNMPFNIRSFEEETKARMGVVECVGHKMIEPFQ---VLYEKPSEIVAQFKH 320
                             |.::.:.|.        :.|.|....|.:.   ....:..:..|||:|
Zfish   338 -----------------PGHVFTIEP--------MICEGGWQDETWPDGWTAVTRDGKRSAQFEH 377

  Fly   321 TVLLMPNGVNLVT 333
            |:|:...|..::|
Zfish   378 TLLVTETGCEILT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 54/273 (20%)
metap1NP_001020336.2 zf-C6H2 31..72 CDD:292429
PLN03158 33..394 CDD:215607 54/273 (20%)
MetAP1 154..391 CDD:238519 54/273 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.