DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and Dip-C

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001287306.1 Gene:Dip-C / 47769 FlyBaseID:FBgn0000455 Length:491 Species:Drosophila melanogaster


Alignment Length:133 Identity:31/133 - (23%)
Similarity:53/133 - (39%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 TCL---SVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGA--AADQKISG 137
            ||:   ..|:.:.|:..|.......::.||:...|:||:..|:.|....|.....  ..|||.. 
  Fly   245 TCICGSGTNSSILHYGHAGAPNSKPVQDGDLCLFDMGANYCGYAADITCTFPANGKFTDDQKFI- 308

  Fly   138 RQADVILAAYWAVQAALRLLKSGANNYSLTDAV--QQISESYKCKPIEGMLSHELKQFKIDGEKT 200
              .:.:|.|..||..:.|...|..:.:.|...|  |::.|.       |||..::::....|...
  Fly   309 --YNAVLDARNAVTESARDGVSWVDMHKLAGRVLLQRLKEG-------GMLKGDVEEMLEAGVSG 364

  Fly   201 IIQ 203
            :.|
  Fly   365 VFQ 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 31/133 (23%)
Dip-CNP_001287306.1 AMP_N 12..158 CDD:198079
PRK10879 57..483 CDD:182804 31/133 (23%)
Prolidase 195..468 CDD:238520 31/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456481
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.