DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and F53B6.5

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_492408.2 Gene:F53B6.5 / 353384 WormBaseID:WBGene00009960 Length:182 Species:Caenorhabditis elegans


Alignment Length:142 Identity:38/142 - (26%)
Similarity:69/142 - (48%) Gaps:23/142 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 SYKCKPIEGMLSHELKQFKIDGEKT--IIQNPSEAQRKEHEKCTFETYEVYAIDVIVSTGEGVGR 238
            |.:.|||..:....:.|.:|..|||  |::...:|:.:|:        |:|||:...|||:|...
 Worm    34 SNEVKPIGSLNGQSIAQCRIHTEKTVPIVKGGEQARMEEN--------EIYAIETFGSTGKGYFH 90

  Fly   239 EKDTKVSIYKK----SEENYMLKMKASRALLAEVKTKYGNMPFNIRSFEE---ETKARMGV---- 292
            : |.:.|.|.|    ::|...|:::.|:.||..:...:..:.| .|.:.:   |||..|.:    
 Worm    91 D-DMETSHYMKNFELADEKIPLRLQKSKGLLNLIDKNFATLAF-CRCWIDRLGETKYLMALKDRW 153

  Fly   293 VECVGHKMIEPF 304
            :..||..:::.|
 Worm   154 MAMVGACILQSF 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 38/142 (27%)
F53B6.5NP_492408.2 APP_MetAP <37..151 CDD:294199 34/123 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.