DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and ApepP

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001246053.1 Gene:ApepP / 35029 FlyBaseID:FBgn0026150 Length:613 Species:Drosophila melanogaster


Alignment Length:170 Identity:37/170 - (21%)
Similarity:68/170 - (40%) Gaps:37/170 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KTIAEDLVVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEETG----KVYKKEKDL 70
            |.|..|:     ::|| .:|..::..:.||...|.:.:...:| .::.|.:|    :.::..||.
  Fly   311 KAIKNDV-----EIAG-FINSHIRDGVALCQYFAWLEDQVNKG-AEVDEMSGADKLESFRSTKDK 368

  Fly    71 KKGIAFPT--CLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGA-HIDGFIAVA----------- 121
            ..|::|.|  ....|..|.|:.| |.:.:..:...::...|.|| ::||...|.           
  Fly   369 YMGLSFTTISASGPNGSVIHYHP-KKETNRKINDKEIYLCDSGAQYLDGTTDVTRTLHFGEPTEF 432

  Fly   122 ---AHTIVV-------GAAADQKISGRQADVIL-AAYWAV 150
               |:|.|:       ......|:.|:..|.:. .|.|.|
  Fly   433 QKEAYTRVLKGQLSFGSTVFPAKVKGQVLDTLARKALWDV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 37/170 (22%)
ApepPNP_001246053.1 Creatinase_N 9..154 CDD:307473
Creatinase_N_2 158..318 CDD:318430 3/11 (27%)
APP 321..545 CDD:238518 33/155 (21%)
Peptidase_M24_C 551..613 CDD:318429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456480
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.