DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and und

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster


Alignment Length:373 Identity:93/373 - (24%)
Similarity:157/373 - (42%) Gaps:87/373 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PEKTIAEDLVVTKYKLAGEIVNKTLKAVI--------------------GLCVVDASVREICTQG 52
            |:...|:|...::.|.|.:.:|..:...:                    |:.::     :||.:.
  Fly   111 PDDRTAKDRFTSEEKRALDRINTDIYQELRQAAEAHRQTRQYMQRYIKPGMTMI-----QICEEL 170

  Fly    53 DNQLTEETGKVYKKEKDLKKGIAFPTCLSVNNCVCHFSPAKNDADYT-LKAGDVVKIDLGAHIDG 116
            :|......|     |..|:.|:||||..|:|:|..|::|  |..|.| |:..||.|||.|.||.|
  Fly   171 ENTARRLIG-----ENGLEAGLAFPTGCSLNHCAAHYTP--NAGDPTVLQYDDVCKIDFGTHIKG 228

  Fly   117 FIAVAAHTIVVGAAADQKISG---------RQADVILAAYWAVQAALRLLKSGANNYSLTDAVQQ 172
            .|...|.|:......|:.:..         |:|.:          .:||...||       |:|:
  Fly   229 RIIDCAFTLTFNNKYDKLLQAVKEATNTGIREAGI----------DVRLCDIGA-------AIQE 276

  Fly   173 ISESYK---------CKPIEGMLSHELKQFKIDGEKTI-IQNPSEAQRKEHEKCTFETYEVYAID 227
            :.|||:         .|.|..:..|.:..::|...||: |....|:.|.|.:       |.|||:
  Fly   277 VMESYEIELDGKTYPIKAIRNLNGHSISPYRIHAGKTVPIVKGGESTRMEED-------EFYAIE 334

  Fly   228 VIVSTGEGVGREKDTKVSIYKKSEENY-----MLKMKASRALLAEVKTKYGNMPFNIRSFEE--E 285
            ...|||.|:..: |...|.|.|   |:     .|::::|:.||..:...:|.:.|..|..:.  .
  Fly   335 TFGSTGRGLVHD-DMDCSHYMK---NFDLPFVPLRLQSSKQLLGTINKNFGTLAFCKRWLDRAGA 395

  Fly   286 TKARMGVVECVGHKMIEPFQVLYEKPSEIVAQFKHTVLLMPNGVNLVT 333
            ||.:|.:.:.....::|.:..|.:......||::||::|.|....:|:
  Fly   396 TKYQMALKDLCDKGIVEAYPPLCDIKGCYTAQYEHTIMLRPTCKEVVS 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 93/373 (25%)
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 93/373 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456476
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.