DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and Metap1

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001099946.1 Gene:Metap1 / 295500 RGDID:1305545 Length:386 Species:Rattus norvegicus


Alignment Length:267 Identity:59/267 - (22%)
Similarity:87/267 - (32%) Gaps:92/267 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FP--TCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGR 138
            ||  .|.|||..:||..|.:.    .|:.||:|.:|:..:.:|:......|..||          
  Rat   189 FPKSCCTSVNEVICHGIPDRR----PLQEGDIVNVDITLYRNGYHGDLNETFFVG---------- 239

  Fly   139 QADVILAAYWAVQAALRLLKSGANNYSLTDAVQQISESYKCKPIEGMLSHELKQFKIDGEKTIIQ 203
              ||...|...||.....|...      .|||         ||  |:...||        ..|||
  Rat   240 --DVDEGARKLVQTTYECLMQA------VDAV---------KP--GVRYREL--------GNIIQ 277

  Fly   204 NPSEAQRKEHEKCTFETYEVYAIDVIVSTGEGVGREKDTKVSIYKKSEENYMLKMKASRALLAEV 268
            ..::|.       .|.....|.       |.|:.:...|..::...::...:..||:......|.
  Rat   278 KHAQAN-------GFSVVRSYC-------GHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEP 328

  Fly   269 KTKYGNMPFNIRSFEEET-------KARMGVVECVGHKMIEPFQVLYEKPSEIVAQFKHTVLLMP 326
            ....|       .:::||       ..|.|                  |.|   |||:||:|:..
  Rat   329 MICEG-------GWQDETWPDGWTAVTRDG------------------KRS---AQFEHTLLVTD 365

  Fly   327 NGVNLVT 333
            .|..::|
  Rat   366 TGCEILT 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 59/267 (22%)
Metap1NP_001099946.1 zf-C6H2 12..53 CDD:292429
PLN03158 14..382 CDD:215607 59/267 (22%)
MetAP1 136..373 CDD:238519 59/267 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.