DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and METAP1D

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_016859239.1 Gene:METAP1D / 254042 HGNCID:32583 Length:358 Species:Homo sapiens


Alignment Length:217 Identity:47/217 - (21%)
Similarity:83/217 - (38%) Gaps:42/217 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAGEIVNKTLKAVIGLCVVDASV-REICTQGDNQLTEETGKVYKKEKDLKKGIAFPTCLSVNNCV 86
            |||    |:||..:....:||.| |||.:.  |......|         ..|.....|.||||.:
Human   126 LAG----KSLKVDMTTEEIDALVHREIISH--NAYPSPLG---------YGGFPKSVCTSVNNVL 175

  Fly    87 CHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAAD-----QKISGRQADVILAA 146
            ||..|...    .|:.||::.||:..:.:|:....:.|.:||...:     .:::.|..|..:||
Human   176 CHGIPDSR----PLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEAIAA 236

  Fly   147 YWAVQAALRLLKSGANNYSLTDAVQQISESYKCKPIEGMLSHELKQFKIDGEKTIIQNPSEAQRK 211
                      .::||....:.:.:..|:.....:.....:.|.:..: ..|...|..:.:::...
Human   237 ----------CRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSY-FHGHPEIWHHANDSDLP 290

  Fly   212 EHEKCTFETYEVYAIDVIVSTG 233
            ..|...|      .|:.|::.|
Human   291 MEEGMAF------TIEPIITEG 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 47/217 (22%)
METAP1DXP_016859239.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.