DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10576 and METAP1

DIOPT Version :9

Sequence 1:NP_001286949.1 Gene:CG10576 / 38645 FlyBaseID:FBgn0035630 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_055958.2 Gene:METAP1 / 23173 HGNCID:15789 Length:386 Species:Homo sapiens


Alignment Length:115 Identity:27/115 - (23%)
Similarity:49/115 - (42%) Gaps:11/115 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 FP--TCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAAADQKISGR 138
            ||  .|.|||..:||..|.:.    .|:.||:|.:|:..:.:|:......|..||...|   ..|
Human   189 FPKSCCTSVNEVICHGIPDRR----PLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDD---GAR 246

  Fly   139 QADVILAAYWAVQAALRLLKSGANNYSLTDAVQQISESYKCKPIEGMLSH 188
            :  ::...|..:..|:..:|.|.....|.:.:|:.:::.....:.....|
Human   247 K--LVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGH 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10576NP_001286949.1 APP_MetAP 3..361 CDD:294199 27/115 (23%)
METAP1NP_055958.2 Zinc finger-like, important for proper ribosome association. /evidence=ECO:0000255|HAMAP-Rule:MF_03174 9..52
zf-C6H2 12..53 CDD:292429
PLN03158 14..382 CDD:215607 27/115 (23%)
MetAP1 136..373 CDD:238519 27/115 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.