DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajc24

DIOPT Version :10

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_081268.1 Gene:Dnajc24 / 99349 MGIID:1919522 Length:148 Species:Mus musculus


Alignment Length:85 Identity:30/85 - (35%)
Similarity:48/85 - (56%) Gaps:12/85 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKS-------PQAEERFKEIAEAYEVLSD--- 57
            ||:|.|||.:..|:..::|:.|:||.|.|||||..:       .:..::|.||.:|:::|.:   
Mouse     9 KDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEET 73

  Fly    58 KKKRDIFDNYGEDGLKGGQP 77
            |||.|:  ...||.|:...|
Mouse    74 KKKYDL--QRHEDELRNVGP 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 29/84 (35%)
Dnajc24NP_081268.1 DnaJ 10..78 CDD:395170 24/67 (36%)
zf-CSL 94..147 CDD:398744
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.