DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnaja2

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_114468.2 Gene:Dnaja2 / 84026 RGDID:71001 Length:412 Species:Rattus norvegicus


Alignment Length:395 Identity:127/395 - (32%)
Similarity:182/395 - (46%) Gaps:113/395 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGED 70
            |.|||:...||::|:||||||||.:||||||  |.|.::||||:.||||||:.:||:::|.|||.
  Rat    10 YDILGVPPGASENELKKAYRKLAKEYHPDKN--PNAGDKFKEISFAYEVLSNPEKRELYDRYGEQ 72

  Fly    71 GLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTNEIFWN 135
            ||:   .|..|||                     |..|.|...|.||...|.|.|..:.|     
  Rat    73 GLR---EGSGGGG---------------------GMDDIFSHIFGGGLFGFMGNQSRSRN----- 108

  Fly   136 IGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISR------------------ 182
                          .|:|.:|  :.|.|.||||::..|...|:::|:                  
  Rat   109 --------------GRRRGED--MMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQ 157

  Fly   183 ----------------MATG-----------SNGP------------------YKEEKVLRITVK 202
                            :|.|           .||.                  .||.|:|.:.|.
  Rat   158 KCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVD 222

  Fly   203 PGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVP 267
            .|.|.|.:|||..|.|.||...|.|||.::::|.|.:|:|:|.||..|.:|.|.:||||...:..
  Rat   223 KGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFK 287

  Fly   268 TLQGSRIQVN-PNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDT--LAPSLQNQLS 329
            .|...:|.|. |..::|:|...|.:.|.|:|..:.|..:|||.:.||::||:.  :.|...::|.
  Rat   288 HLDARQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELE 352

  Fly   330 ELLPN 334
            :|||:
  Rat   353 DLLPS 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 125/392 (32%)
DnaJ 4..65 CDD:278647 35/58 (60%)
DnaJ_C 157..320 CDD:199909 64/228 (28%)
Dnaja2NP_114468.2 PTZ00037 4..412 CDD:240236 127/395 (32%)
CXXCXGXG motif 143..150 0/6 (0%)
CXXCXGXG motif 159..166 0/6 (0%)
CXXCXGXG motif 186..193 2/6 (33%)
CXXCXGXG motif 202..209 0/6 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.