DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and AT1G11040

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_172571.1 Gene:AT1G11040 / 837645 AraportID:AT1G11040 Length:438 Species:Arabidopsis thaliana


Alignment Length:190 Identity:70/190 - (36%)
Similarity:108/190 - (56%) Gaps:5/190 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 FNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISR-MATGSNGPYKEEKVLRITVKPGWKA 207
            |:...|.:|   .|.:|..|..:|||:..|.:|.:||.| :.|......::|::||:.::||||.
plant   247 FSQSTPPKK---PPAVEKKLECTLEELCHGGVKNIKIKRDIITDEGLIMQQEEMLRVNIQPGWKK 308

  Fly   208 GTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGS 272
            ||||||...|:..|...|.||.|::.:|.|.||||.|.||:...:|.|.:||.|..:|||.|.|.
plant   309 GTKITFEGVGNEKPGYLPEDITFVVEEKRHPLFKRRGDDLEIAVEIPLLKALTGCKLSVPLLSGE 373

  Fly   273 RIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSELL 332
            .:.:... ::|.....:.|.|.|:|..||..:||||.::|.:.||:.|:...::...|:|
plant   374 SMSITVG-DVIFHGFEKAIKGQGMPNAKEEGKRGDLRITFLVNFPEKLSEEQRSMAYEVL 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 70/190 (37%)
DnaJ 4..65 CDD:278647
DnaJ_C 157..320 CDD:199909 64/163 (39%)
AT1G11040NP_172571.1 DnaJ_C 259..420 CDD:199909 63/161 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 148 1.000 Domainoid score I1434
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24078
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.