DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and J2

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_568412.1 Gene:J2 / 832267 AraportID:AT5G22060 Length:419 Species:Arabidopsis thaliana


Alignment Length:394 Identity:123/394 - (31%)
Similarity:179/394 - (45%) Gaps:113/394 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGE 69
            ||:|||:.:.|:.:::||||:|.|:|.||||...|   |:|||:|:|||||||.:||:|:|.|||
plant    15 FYEILGVPKTAAPEDLKKAYKKAAIKNHPDKGGDP---EKFKELAQAYEVLSDPEKREIYDQYGE 76

  Fly    70 DGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGS-SDPFGAFFTGGDNMFSGGQGGNTNEIF 133
            |.||.|..|..||          | ||...|:.|||| ..|||:...|                 
plant    77 DALKEGMGGGGGG----------H-DPFDIFSSFFGSGGHPFGSHSRG----------------- 113

  Fly   134 WNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSN---------- 188
                             |::::...:.|.|.||||:|..|..||:.:||.|..|.          
plant   114 -----------------RRQRRGEDVVHPLKVSLEDVYLGTTKKLSLSRKALCSKCNGKGSKSGA 161

  Fly   189 -------------------GP----------------------------------YKEEKVLRIT 200
                               ||                                  ..|:|||.:.
plant   162 SMKCGGCQGSGMKISIRQFGPGMMQQVQHACNDCKGTGETINDRDRCPQCKGEKVVSEKKVLEVN 226

  Fly   201 VKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVS 265
            |:.|.:...||||..:.|.||:....||||:|:.|.|..|||:|.||.....|||.:||||....
plant   227 VEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALCGFQFV 291

  Fly   266 VPTLQGSRIQVNPN-HEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLS 329
            :..|...::.:... .|::||.:.:.|:..|:|:.:.|..:|.|.:.|.::||::|:|.....:.
plant   292 LTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPESLSPDQTKAIE 356

  Fly   330 ELLP 333
            .:||
plant   357 AVLP 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 121/392 (31%)
DnaJ 4..65 CDD:278647 33/59 (56%)
DnaJ_C 157..320 CDD:199909 62/226 (27%)
J2NP_568412.1 PTZ00037 7..419 CDD:240236 123/394 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.