DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and AT4G10130

DIOPT Version :10

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_192751.1 Gene:AT4G10130 / 826604 AraportID:AT4G10130 Length:174 Species:Arabidopsis thaliana


Alignment Length:66 Identity:27/66 - (40%)
Similarity:44/66 - (66%) Gaps:4/66 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FYKILGLERKASDDEIKKAYRKLALKYHPDK----NKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            :|:||.::..||.:||:.:||...|..||||    ::|...:|:|.:|.:|:|||||.:.|.::|
plant    12 YYEILSVKEDASYEEIRNSYRSAILHSHPDKLNNTSRSSSDDEKFLKIQKAWEVLSDAELRVVYD 76

  Fly    66 N 66
            |
plant    77 N 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 27/66 (41%)
AT4G10130NP_192751.1 DnaJ 11..76 CDD:395170 25/63 (40%)
zf-CSL 90..164 CDD:419794
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.