DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and J3

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_189997.1 Gene:J3 / 823531 AraportID:AT3G44110 Length:420 Species:Arabidopsis thaliana


Alignment Length:393 Identity:127/393 - (32%)
Similarity:182/393 - (46%) Gaps:112/393 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGE 69
            ||:|||:.:.||.:::||||:|.|:|.||||...|   |:|||:|:|||||||.:||:|:|.|||
plant    15 FYEILGVPKSASPEDLKKAYKKAAIKNHPDKGGDP---EKFKELAQAYEVLSDPEKREIYDQYGE 76

  Fly    70 DGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTNEIFW 134
            |.||.|..|..||          | ||...|:.|||.. ||               ||||:.   
plant    77 DALKEGMGGGGGG----------H-DPFDIFSSFFGGG-PF---------------GGNTSR--- 111

  Fly   135 NIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSN----------- 188
                           .|::::...:.|.|.||||:|..|.:||:.:||.|..|.           
plant   112 ---------------QRRQRRGEDVVHPLKVSLEDVYLGTMKKLSLSRNALCSKCNGKGSKSGAS 161

  Fly   189 ------------------GP----------------------------------YKEEKVLRITV 201
                              ||                                  ..|:|||.:.|
plant   162 LKCGGCQGSGMKVSIRQLGPGMIQQMQHACNECKGTGETINDRDRCPQCKGDKVIPEKKVLEVNV 226

  Fly   202 KPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSV 266
            :.|.:...||||..:.|.||:....||||:::.|.|..|||:|.||.....:||.:||||....:
plant   227 EKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALCGFQFVL 291

  Fly   267 PTLQGSRIQVNPN-HEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAPSLQNQLSE 330
            ..|.|..:.:..| .|::||.:.:.|:..|:|:.:.|..:|.|.:.|.::|||:|:|.....|..
plant   292 THLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDSLSPDQTKALEA 356

  Fly   331 LLP 333
            :||
plant   357 VLP 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 125/391 (32%)
DnaJ 4..65 CDD:278647 34/59 (58%)
DnaJ_C 157..320 CDD:199909 63/226 (28%)
J3NP_189997.1 PTZ00037 7..420 CDD:240236 127/393 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.