DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and DNAJB14

DIOPT Version :10

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001026893.1 Gene:DNAJB14 / 79982 HGNCID:25881 Length:379 Species:Homo sapiens


Alignment Length:135 Identity:51/135 - (37%)
Similarity:74/135 - (54%) Gaps:19/135 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
            |::|::||:.:.|.|:::||||||||||:|||||.:|.|.:.||:|..||.|||:.:||..:|  
Human   107 KNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFKKIGNAYAVLSNPEKRKQYD-- 169

  Fly    68 GEDGLKGGQPGPDGGGQPGAYTYQFHG------DPRATFAQFFGSSDPFGAFFTGGDNMFSGGQG 126
                |.|.:.........|  .:.||.      .|...|..|||     |.|.:|..:.||.|:.
Human   170 ----LTGNEEQACNHQNNG--RFNFHRGCEADITPEDLFNIFFG-----GGFPSGSVHSFSNGRA 223

  Fly   127 GNTNE 131
            |.:.:
Human   224 GYSQQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 50/134 (37%)
DNAJB14NP_001026893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..94
DnaJ_bact 109..>214 CDD:274090 45/117 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..241 3/10 (30%)
DUF1977 271..369 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.