DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajc18

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_083945.1 Gene:Dnajc18 / 76594 MGIID:1923844 Length:357 Species:Mus musculus


Alignment Length:200 Identity:65/200 - (32%)
Similarity:96/200 - (48%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
            :::|.|||:...|||:|:||||:|||||:|||||.:|.|.|.||.|..|:.|||:..||..:|.|
Mouse    81 RNYYDILGVSHNASDEELKKAYKKLALKFHPDKNCAPGATEAFKAIGNAFAVLSNPDKRLRYDEY 145

  Fly    68 GEDGLKGGQPGPDGGGQPGAYTYQFHGD------PRATFAQFFGSSDPFGAFFTGGDNMFSGGQG 126
            |::.:.        ...|.|.:|.::.|      |...|..|||     |.|.:|..:|||    
Mouse   146 GDEQVT--------FTVPRARSYHYYKDFEADISPEELFNVFFG-----GHFPSGNIHMFS---- 193

  Fly   127 GNTNEIFWNIGGDDMF----AFNAQAPSRKRQQD-PPIEHDLFVSLEEVDKGCIKKMKISRMATG 186
                    |:..|..:    ..:.:..:.||::| ....:..||.|..|  ..|..:.:......
Mouse   194 --------NVTDDSQYYRRRHRHERTQTHKREEDKSQTPYSAFVQLLPV--LVIVTISVITQLLA 248

  Fly   187 SNGPY 191
            :|.||
Mouse   249 ANPPY 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 64/199 (32%)
DnaJ 4..65 CDD:278647 34/60 (57%)
DnaJ_C 157..320 CDD:199909 7/34 (21%)
Dnajc18NP_083945.1 PRK14298 81..>182 CDD:184612 46/113 (41%)
DUF1977 250..349 CDD:370429 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.