Sequence 1: | NP_523936.2 | Gene: | DnaJ-1 / 38643 | FlyBaseID: | FBgn0263106 | Length: | 334 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083945.1 | Gene: | Dnajc18 / 76594 | MGIID: | 1923844 | Length: | 357 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 65/200 - (32%) |
---|---|---|---|
Similarity: | 96/200 - (48%) | Gaps: | 38/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
Fly 68 GEDGLKGGQPGPDGGGQPGAYTYQFHGD------PRATFAQFFGSSDPFGAFFTGGDNMFSGGQG 126
Fly 127 GNTNEIFWNIGGDDMF----AFNAQAPSRKRQQD-PPIEHDLFVSLEEVDKGCIKKMKISRMATG 186
Fly 187 SNGPY 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DnaJ-1 | NP_523936.2 | DnaJ | 1..333 | CDD:223560 | 64/199 (32%) |
DnaJ | 4..65 | CDD:278647 | 34/60 (57%) | ||
DnaJ_C | 157..320 | CDD:199909 | 7/34 (21%) | ||
Dnajc18 | NP_083945.1 | PRK14298 | 81..>182 | CDD:184612 | 46/113 (41%) |
DUF1977 | 250..349 | CDD:370429 | 2/3 (67%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |