DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb13

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_705755.2 Gene:Dnajb13 / 69387 MGIID:1916637 Length:316 Species:Mus musculus


Alignment Length:335 Identity:147/335 - (43%)
Similarity:203/335 - (60%) Gaps:24/335 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGKDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            ||.|:|.:|.:.|.:.|.:|||||||||||.||.|:..|.|.|.||:|||||:||||..||.|:|
Mouse     1 MGLDYYAVLQVTRNSEDAQIKKAYRKLALKNHPLKSSEPGAPEIFKQIAEAYDVLSDPVKRGIYD 65

  Fly    66 NYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTN 130
            .:||:|||||.|...|...|....|.|||:|...|.:|||..:||..||        ..:|   |
Mouse    66 KFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPDKVFHEFFGGDNPFSEFF--------DAEG---N 119

  Fly   131 EIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSNGPYK--- 192
            :|..|.||  ::....|      :||||||.||::|||::..||.||:||||.....: .|.   
Mouse   120 DIDLNFGG--LWGRGVQ------KQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNED-RYSSTI 175

  Fly   193 EEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQ 257
            ::|:|.|.|:|||:.||:|||.:|||..||..||||:||:::|.|..|:||..:|.:...|.|.:
Mouse   176 KDKILTIDVRPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRREHDNLFFVYPIPLGK 240

  Fly   258 ALCGALVSVPTLQGSRIQVNPNHEIIKPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFPDTLAP 322
            ||....|.|.||....:.: |.::|:.|...:.:.|.|:|:|:.||::|||.:.|||:||..|.|
Mouse   241 ALTCCTVEVKTLDDRLLNI-PINDIVHPKYFKIVPGEGMPLPENPSKKGDLFIFFDIQFPTRLTP 304

  Fly   323 SLQNQLSELL 332
            ..:..|.:.|
Mouse   305 QKKQMLRQAL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 147/335 (44%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 157..320 CDD:199909 72/165 (44%)
Dnajb13NP_705755.2 DnaJ 1..312 CDD:223560 146/331 (44%)
DnaJ 4..65 CDD:278647 36/60 (60%)
DnaJ_C 138..302 CDD:199909 72/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53515
OrthoDB 1 1.010 - - D1393097at2759
OrthoFinder 1 1.000 - - FOG0000274
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100302
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X227
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.