DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb3

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001102866.1 Gene:Dnajb3 / 680216 RGDID:1594215 Length:241 Species:Rattus norvegicus


Alignment Length:129 Identity:61/129 - (47%)
Similarity:81/129 - (62%) Gaps:18/129 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKN--KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            |:|::||:.|:||.:.|:|||||||||:|||||  ...:||.|||::|:|||||||.:||:::|.
  Rat     3 DYYEVLGVPRQASAEAIRKAYRKLALKWHPDKNPEHKEEAERRFKQVAQAYEVLSDARKREVYDR 67

  Fly    67 YGEDGLKGGQPGPDGGGQPGA-------YTYQFHGDPRATFAQFFGSSDPFGAFFTGG--DNMF 121
            .||.|..|      |||..|:       |.:.|. ||...|.:|||..|||...|.|.  :|.|
  Rat    68 CGEVGEVG------GGGAAGSPFHDAFQYVFSFR-DPAEVFREFFGGHDPFSFDFFGDPLENFF 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 61/129 (47%)
DnaJ 4..65 CDD:278647 37/62 (60%)
DnaJ_C 157..320 CDD:199909
Dnajb3NP_001102866.1 DnaJ 3..66 CDD:395170 37/62 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347694
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.