DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-1 and dnajc3b

DIOPT Version :9

Sequence 1:	NP_523936.2	Gene:	DnaJ-1 / 38643	FlyBaseID:	FBgn0263106	Length:	334	Species:	Drosophila melanogaster
Sequence 2:	NP_571705.1	Gene:	dnajc3b / 58154	ZFINID:	ZDB-GENE-000831-4	Length:	502	Species:	Danio rerio

Alignment Length:	148	Identity:	55/148 - (37%)
Similarity:	72/148 - (48%)	Gaps:	47/148 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKS----PQAEERFKEIAEAYEVLSDKKKRDI 63
            :|:|||||:.|.|:..||.|||||||.::|||..:|    .:||::|.:||.|.|||:|.:.|..
Zfish   395 RDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSEADKKEAEKKFIDIASAKEVLTDPEMRQK 459

  Fly    64 FDNYGEDGL-KGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGG 127
            ||: |||.| ...|.|..|||            ||..         |||         |:..:||
Zfish   460 FDS-GEDPLDPENQQGGGGGG------------PREW---------PFG---------FNPFEGG 493

  Fly   128 NTNEIFWNIGGDDMFAFN 145
            |.:           |.||
Zfish   494 NFH-----------FKFN 500

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-1	NP_523936.2	DnaJ	1..333	CDD:223560	55/148 (37%)
		DnaJ	4..65	CDD:278647	32/64 (50%)
		DnaJ_C	157..320	CDD:199909
dnajc3b	NP_571705.1	TPR_11	41..107	CDD:290150
		TPR repeat	42..70	CDD:276809
		TPR repeat	75..105	CDD:276809
		TPR_11	77..141	CDD:290150
		TPR repeat	110..137	CDD:276809
		TPR repeat	157..184	CDD:276809
		TPR_11	189..254	CDD:290150
		TPR repeat	190..218	CDD:276809
		TPR repeat	223..253	CDD:276809
		TPR repeat	303..337	CDD:276809
		TPR repeat	342..370	CDD:276809
		TPR	348..375	CDD:197478
		DnaJ	394..>500	CDD:223560	53/146 (36%)
		DnaJ	396..461	CDD:278647	32/64 (50%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910