DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb2

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_036008391.1 Gene:Dnajb2 / 56812 MGIID:1928739 Length:365 Species:Mus musculus


Alignment Length:270 Identity:63/270 - (23%)
Similarity:94/270 - (34%) Gaps:82/270 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGEDGLKGGQPGPD----GGGQPGAYTYQFHG 94
            |...||:....|.:......:|.: .||:|:|.||.:||.|...||.    ||..|| :|:.|. 
Mouse    77 DTRPSPRGAITFLKGGMTRSLLLE-HKREIYDRYGREGLTGAGSGPSRSETGGAGPG-FTFTFR- 138

  Fly    95 DPRATFAQFFGSSDPF---------------------GAFFTGGDNM------------FSGGQG 126
            .|...|.:||||.|||                     |.|||...:.            ||.|.|
Mouse   139 SPEEVFREFFGSGDPFSELFDDLGVFSELQNQGPRLTGPFFTFSSSFPANSDFSSSSFSFSPGAG 203

  Fly   127 GNTNEIFWNIGGDDMFAFNAQAPSRK----RQQDPPIEHDLFVSLEEVDKGCIKKMKIS----RM 183
            .     |.::.....|....:..:|:    .|:...:|.|          |.:|.:.|:    .:
Mouse   204 A-----FRSVSTSTTFVQGRRITTRRIMENGQERVEVEED----------GQLKSVSINGVPDDL 253

  Fly   184 ATGSNGPYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLK 248
            |.|.....:|::.   :|.||  .|.....|..              :.|...|.|.:.|.:.|.
Mouse   254 ALGLELSRREQQP---SVAPG--LGVMQVRPTS--------------LSRPPDHDLSEDEDLQLA 299

  Fly   249 YTAQISLKQA 258
            ....:|..:|
Mouse   300 MAYSLSEMEA 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 63/270 (23%)
DnaJ 4..65 CDD:278647 8/30 (27%)
DnaJ_C 157..320 CDD:199909 20/106 (19%)
Dnajb2XP_036008391.1 PRK14294 102..>151 CDD:237664 22/50 (44%)
UIM 291..310 CDD:197845 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.