Sequence 1: | NP_523936.2 | Gene: | DnaJ-1 / 38643 | FlyBaseID: | FBgn0263106 | Length: | 334 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_036008391.1 | Gene: | Dnajb2 / 56812 | MGIID: | 1928739 | Length: | 365 | Species: | Mus musculus |
Alignment Length: | 270 | Identity: | 63/270 - (23%) |
---|---|---|---|
Similarity: | 94/270 - (34%) | Gaps: | 82/270 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 34 DKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNYGEDGLKGGQPGPD----GGGQPGAYTYQFHG 94
Fly 95 DPRATFAQFFGSSDPF---------------------GAFFTGGDNM------------FSGGQG 126
Fly 127 GNTNEIFWNIGGDDMFAFNAQAPSRK----RQQDPPIEHDLFVSLEEVDKGCIKKMKIS----RM 183
Fly 184 ATGSNGPYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTPADIVFIIRDKPHSLFKREGIDLK 248
Fly 249 YTAQISLKQA 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DnaJ-1 | NP_523936.2 | DnaJ | 1..333 | CDD:223560 | 63/270 (23%) |
DnaJ | 4..65 | CDD:278647 | 8/30 (27%) | ||
DnaJ_C | 157..320 | CDD:199909 | 20/106 (19%) | ||
Dnajb2 | XP_036008391.1 | PRK14294 | 102..>151 | CDD:237664 | 22/50 (44%) |
UIM | 291..310 | CDD:197845 | 4/19 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167844332 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |