DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Samd13

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_064474.1 Gene:Samd13 / 56764 RGDID:708544 Length:223 Species:Rattus norvegicus


Alignment Length:228 Identity:70/228 - (30%)
Similarity:107/228 - (46%) Gaps:39/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQ--AEERFKEIAEAYEVLSDKKKRDIFD- 65
            ::||:||:.:.||..:||||:.:|||:.|||||...:  |||:||::||||::|||.|||..:| 
  Rat     3 NYYKVLGVPQDASSSDIKKAFHQLALQVHPDKNPGDREAAEEKFKQVAEAYQILSDAKKRKDYDR 67

  Fly    66 ----NYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSG--- 123
                ...|:.::|     ||..:...........||.||.......|.|     .||.:|:|   
  Rat    68 SRWSRTKEELIRG-----DGRDETNWEEEICSRRPRRTFQTVIEDEDLF-----SGDYLFTGPMT 122

  Fly   124 -GQGGNTNEIFWNIGG--DDMFAFNAQAPSRKRQQD-----PPIEHD-----LFVSLEEVDKGCI 175
             .:.|::|  |:.:..  |..|:......|:....|     |.|.|.     |..:..::..|  
  Rat   123 HSRRGSSN--FFTVTPIIDTGFSTFVSQESKSSPDDSEAFVPYISHGMGKFRLVTTCSQIMNG-- 183

  Fly   176 KKMKISRMATGSNGPYK--EEKVLRITVKPGWK 206
            |::...|:.....||.|  .|::.|.....|||
  Rat   184 KRVVTKRVVENIQGPKKIENERLFRWNPSRGWK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 70/228 (31%)
DnaJ 4..65 CDD:278647 33/62 (53%)
DnaJ_C 157..320 CDD:199909 15/57 (26%)
Samd13NP_064474.1 DnaJ 2..>67 CDD:223560 33/63 (52%)
DnaJ 3..66 CDD:278647 33/62 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347690
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.