DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb12

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001361685.1 Gene:Dnajb12 / 56709 MGIID:1931881 Length:378 Species:Mus musculus


Alignment Length:149 Identity:57/149 - (38%)
Similarity:72/149 - (48%) Gaps:37/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
            ||:|:|||:.|.|||:::||||||||||:|||||.:|.|.|.||.|..||.|||:.:||..:|.:
Mouse   110 KDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLSNPEKRKQYDQF 174

  Fly    68 GEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGG--------------- 117
            |:|..:..:.|            ..|||....|.......|.|..||.||               
Mouse   175 GDDKSQAARHG------------HSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYSNGRMR 227

  Fly   118 ----------DNMFSGGQG 126
                      ||...||.|
Mouse   228 YTYQQRQDRRDNQGDGGLG 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 57/149 (38%)
DnaJ 4..65 CDD:278647 37/60 (62%)
DnaJ_C 157..320 CDD:199909
Dnajb12NP_001361685.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 45..97
DnaJ_bact 111..>237 CDD:274090 51/137 (37%)
DUF1977 269..369 CDD:370429
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844338
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.