DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb8

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_064348.1 Gene:Dnajb8 / 56691 MGIID:1922801 Length:227 Species:Mus musculus


Alignment Length:252 Identity:75/252 - (29%)
Similarity:110/252 - (43%) Gaps:85/252 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKN--KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            ::|::||::..||.::||||||||||::|||||  ...:||::||:::||||||||.|||.::|.
Mouse     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDR 67

  Fly    67 YGEDGLKGG------QPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSG-- 123
            .|.|..:.|      ...|.|.|.|       ..:|...|.:|||..|||.  |...|..|||  
Mouse    68 AGCDRWRAGGGANVPHSSPFGAGYP-------FRNPEDIFREFFGGLDPFS--FEFWDTPFSGRG 123

  Fly   124 -----------------------------GQGGNTNEIF--WNIGGDDMFAF----------NAQ 147
                                         |.||.:...|  .:.||.....|          |.:
Mouse   124 RPHGLHRVFPSGFGEFPAFMEALSSFNTLGHGGGSRSTFSSASFGGSGSSGFKSVMSSTEMVNGR 188

  Fly   148 APSRKR-----QQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGSNGPYKEEKVLRI 199
            ..:.||     |:...:|.|          |.::.:.:       ||   :||::|:
Mouse   189 KVTTKRIIENGQERVEVEED----------GQLRSVTV-------NG---KEKLMRV 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 75/252 (30%)
DnaJ 4..65 CDD:278647 35/62 (56%)
DnaJ_C 157..320 CDD:199909 8/43 (19%)
Dnajb8NP_064348.1 DnaJ 3..66 CDD:278647 35/62 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844298
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.