DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnajc18

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001107060.1 Gene:dnajc18 / 559928 ZFINID:ZDB-GENE-030131-8019 Length:407 Species:Danio rerio


Alignment Length:344 Identity:91/344 - (26%)
Similarity:130/344 - (37%) Gaps:131/344 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
            :|||:|||:.:.|||:::|||||||||::|||||.:|.|.:.||.|..||.|||:.:||..:|.|
Zfish   120 RDFYEILGVPKGASDEDLKKAYRKLALRFHPDKNCAPGATDAFKAIGNAYAVLSNPEKRQQYDEY 184

  Fly    68 GEDGLKGGQPGPDGGGQPGA-----------YTYQFHGD--PRATFAQFFGSSDPFGAFFTGGDN 119
            |:.|     |. :...||.|           :|..|..|  |...|..|||     |.|.||..:
Zfish   185 GDQG-----PA-ETSSQPSAQPRQAYARHRSFTRDFEPDISPEELFNIFFG-----GRFPTGNIH 238

  Fly   120 MFSGGQGGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMA 184
            :::.|...              :|...| |.|:|    |.|.                       
Zfish   239 VYTNGGAS--------------YAHYYQ-PRRRR----PFER----------------------- 261

  Fly   185 TGSNGPYKEEKVLRITVKPGWKAGTKITFPQEGDSAPNKTP-----ADIVFII---------RDK 235
                   :||:|                  :|..|..|.||     ..:|.|:         .:.
Zfish   262 -------REEEV------------------EESHSTNNFTPLLQLLPVLVLIVISVFTQLMATNP 301

  Fly   236 PHSLFKREGIDL-----------KYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEIIKPTTTR 289
            |:|||.:..:.|           .|....|.::...||.:.               |:.|...|.
Zfish   302 PYSLFYKPSMGLVVSRETQHMGVPYYVDKSFEKEYRGAALD---------------ELEKTIETD 351

  Fly   290 RINGLGLPVPKEPSRRGDL 308
            .|:.|.....||..::.||
Zfish   352 YIDHLQSSCWKEKQQKSDL 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 91/344 (26%)
DnaJ 4..65 CDD:278647 35/60 (58%)
DnaJ_C 157..320 CDD:199909 30/177 (17%)
dnajc18NP_001107060.1 DnaJ 121..182 CDD:278647 35/60 (58%)
DUF1977 299..399 CDD:286411 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589194
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.