DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnajb9b

DIOPT Version :10

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_073802162.1 Gene:dnajb9b / 554091 ZFINID:ZDB-GENE-050522-76 Length:240 Species:Danio rerio


Alignment Length:48 Identity:31/48 - (64%)
Similarity:42/48 - (87%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAE 50
            ||:|:|||:.:.|||.:||||:.|||:::||||||||.||.:|:||||
Zfish    25 KDYYEILGVPKDASDRQIKKAFHKLAMRFHPDKNKSPDAEAKFREIAE 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 30/47 (64%)
dnajb9bXP_073802162.1 None

Return to query results.
Submit another query.