DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and dnajb14

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001016588.1 Gene:dnajb14 / 549342 XenbaseID:XB-GENE-952313 Length:375 Species:Xenopus tropicalis


Alignment Length:199 Identity:68/199 - (34%)
Similarity:92/199 - (46%) Gaps:40/199 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
            |.:|::||:...|.::::||||||||||:|||||.:|.|.|.||:|..||.|||:.:||..:|  
 Frog   105 KTYYEVLGVSTDAGEEDLKKAYRKLALKFHPDKNHAPGATEAFKKIGNAYAVLSNPEKRKQYD-- 167

  Fly    68 GEDGLKGGQPGPDGGGQPGAYTYQ--FHGD--PRATFAQFFGSSDPFGAF--FTGGDNMFSGGQ- 125
                |.|.:.......:.|.:.|.  |..|  |...|..|||...|.|:.  |:.|...:|..| 
 Frog   168 ----LTGSEDQMQNNHRNGGFDYHRGFEADITPEDLFNMFFGGGFPSGSVHTFSNGRARYSHHQH 228

  Fly   126 ---GGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGS 187
               .|:..|.....||..||.           |..||...:.|||            :|:... |
 Frog   229 HHHSGHDREDERADGGFSMFI-----------QLMPIIVLILVSL------------LSQFMV-S 269

  Fly   188 NGPY 191
            |.||
 Frog   270 NPPY 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 68/199 (34%)
DnaJ 4..65 CDD:278647 32/60 (53%)
DnaJ_C 157..320 CDD:199909 10/35 (29%)
dnajb14NP_001016588.1 FliS 6..>34 CDD:382133
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95
DnaJ_bact 107..>212 CDD:274090 45/110 (41%)
DUF1977 269..367 CDD:370429 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.