Sequence 1: | NP_523936.2 | Gene: | DnaJ-1 / 38643 | FlyBaseID: | FBgn0263106 | Length: | 334 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001016588.1 | Gene: | dnajb14 / 549342 | XenbaseID: | XB-GENE-952313 | Length: | 375 | Species: | Xenopus tropicalis |
Alignment Length: | 199 | Identity: | 68/199 - (34%) |
---|---|---|---|
Similarity: | 92/199 - (46%) | Gaps: | 40/199 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFDNY 67
Fly 68 GEDGLKGGQPGPDGGGQPGAYTYQ--FHGD--PRATFAQFFGSSDPFGAF--FTGGDNMFSGGQ- 125
Fly 126 ---GGNTNEIFWNIGGDDMFAFNAQAPSRKRQQDPPIEHDLFVSLEEVDKGCIKKMKISRMATGS 187
Fly 188 NGPY 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DnaJ-1 | NP_523936.2 | DnaJ | 1..333 | CDD:223560 | 68/199 (34%) |
DnaJ | 4..65 | CDD:278647 | 32/60 (53%) | ||
DnaJ_C | 157..320 | CDD:199909 | 10/35 (29%) | ||
dnajb14 | NP_001016588.1 | FliS | 6..>34 | CDD:382133 | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 48..95 | ||||
DnaJ_bact | 107..>212 | CDD:274090 | 45/110 (41%) | ||
DUF1977 | 269..367 | CDD:370429 | 4/5 (80%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |