DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment DnaJ-1 and DNAJC10

DIOPT Version :9

Sequence 1:	NP_523936.2	Gene:	DnaJ-1 / 38643	FlyBaseID:	FBgn0263106	Length:	334	Species:	Drosophila melanogaster
Sequence 2:	NP_061854.1	Gene:	DNAJC10 / 54431	HGNCID:	24637	Length:	793	Species:	Homo sapiens

Alignment Length:	138	Identity:	52/138 - (37%)
Similarity:	70/138 - (50%)	Gaps:	30/138 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 KDFYKILGLERKASDDEIKKAYRKLALKYHPDKN-KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            :|||.:||:.:.||..||::|::|||||.||||| .:|.|...|.:|..|||||.|:..|..:|.
Human    34 QDFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDK 98

  Fly    67 YGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFG--SSDP---------FGAFFTGGD-- 118
            |||.||:..|     |||..::.|         :...||  ..||         |.|....|:
Human    99 YGEKGLEDNQ-----GGQYESWNY---------YRYDFGIYDDDPEIITLERREFDAAVNSGELW 149

  Fly   119 --NMFSGG 124
              |.:|.|
Human   150 FVNFYSPG 157

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
DnaJ-1	NP_523936.2	DnaJ	1..333	CDD:223560	52/138 (38%)
		DnaJ	4..65	CDD:278647	31/61 (51%)
		DnaJ_C	157..320	CDD:199909
DNAJC10	NP_061854.1	DnaJ	34..>132	CDD:223560	46/111 (41%)
		PDI_a_ERdj5_N	129..229	CDD:239301	7/29 (24%)
		Trxb 1	235..350
		Trxb 2	348..463
		PDI_a_ERdj5_C	453..550	CDD:239302
		PDI_a_ERdj5_C	556..663	CDD:239302
		PDI_a_ERdj5_C	670..775	CDD:239302
		Prevents secretion from ER. /evidence=ECO:0000255\|PROSITE-ProRule:PRU10138	790..793
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910