DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and DNAJB11

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_057390.1 Gene:DNAJB11 / 51726 HGNCID:14889 Length:358 Species:Homo sapiens


Alignment Length:375 Identity:118/375 - (31%)
Similarity:168/375 - (44%) Gaps:98/375 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GKDFYKILGLERKASDDEIKKAYRKLALKYHPDKN-KSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            |:|||||||:.|.||..:||||||||||:.|||:| ..|||:|:|:::..|||||||.:||..:|
Human    23 GRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDLGAAYEVLSDSEKRKQYD 87

  Fly    66 NYGEDGLKGGQPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPFGAFFTGGDNMFSGGQGGNTN 130
            .|||:|||.|....             |||   .|:.|||.   ||..|.|              
Human    88 TYGEEGLKDGHQSS-------------HGD---IFSHFFGD---FGFMFGG-------------- 119

  Fly   131 EIFWNIGGDDMFAFNAQAPSRKRQQDPPIEH------DLFVSLEEVDKG----CIKKMKISRMAT 185
                                ..||||..|..      ||.|:||||..|    .::...::|.|.
Human   120 --------------------TPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAP 164

  Fly   186 GSN-------------GP-------------------YKEEKVLRITVKPGWKAGTKITFPQEGD 218
            |..             ||                   ..||:.|.:.::||.:.|.:..|..||:
Human   165 GKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEVEIEPGVRDGMEYPFIGEGE 229

  Fly   219 SAPNKTPADIVFIIRDKPHSLFKREGIDLKYTAQISLKQALCGALVSVPTLQGSRIQVNPNHEII 283
            ...:..|.|:.|.|:...|.:|:|.|.||.....|||.::|.|..:.:..|.|.::.:: ..:|.
Human   230 PHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHLDGHKVHIS-RDKIT 293

  Fly   284 KPTTTRRINGLGLPVPKEPSRRGDLIVSFDIKFP-DTLAPSLQNQLSELL 332
            :|.......|.|||.....:.:|.||::||:.|| :.|....:..:.:||
Human   294 RPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 118/375 (31%)
DnaJ 4..65 CDD:278647 38/61 (62%)
DnaJ_C 157..320 CDD:199909 53/205 (26%)
DNAJB11NP_057390.1 DnaJ 22..344 CDD:223560 118/375 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.