DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and AT3G06778

DIOPT Version :10

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001078117.1 Gene:AT3G06778 / 5007987 AraportID:AT3G06778 Length:229 Species:Arabidopsis thaliana


Alignment Length:62 Identity:33/62 - (53%)
Similarity:41/62 - (66%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKNKSPQAEERFKEIAEAYEVLSDKKKRDIFD 65
            |:|.|||::..|....|:|.|.|||||.|||||..|:|:..||.|.|||..|||:.||..|:
plant    42 DWYLILGIQEDAEVKVIRKRYHKLALKVHPDKNNHPKADIAFKLIHEAYLCLSDETKRRSFN 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ_bact 4..332 CDD:274090 33/62 (53%)
AT3G06778NP_001078117.1 DnaJ 42..103 CDD:395170 32/60 (53%)

Return to query results.
Submit another query.