DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DnaJ-1 and Dnajb8

DIOPT Version :9

Sequence 1:NP_523936.2 Gene:DnaJ-1 / 38643 FlyBaseID:FBgn0263106 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_001102718.1 Gene:Dnajb8 / 500253 RGDID:1561981 Length:230 Species:Rattus norvegicus


Alignment Length:248 Identity:80/248 - (32%)
Similarity:119/248 - (47%) Gaps:69/248 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DFYKILGLERKASDDEIKKAYRKLALKYHPDKN--KSPQAEERFKEIAEAYEVLSDKKKRDIFDN 66
            ::|::||::..||.::||||||||||::|||||  ...:||::||:::||||||||.|||.::|.
  Rat     3 NYYEVLGVQSSASPEDIKKAYRKLALRWHPDKNPDNKEEAEKKFKQVSEAYEVLSDSKKRSVYDR 67

  Fly    67 YGEDGLKGG------QPGPDGGGQPGAYTYQFHGDPRATFAQFFGSSDPF--------------- 110
            .|.||.:.|      ..||.|.|.|       ..:|...|.:|||..|||               
  Rat    68 AGCDGWRAGGGASVPHAGPFGAGYP-------FRNPEDIFREFFGGLDPFSFEFWDTPFSDRGRP 125

  Fly   111 ----GAFFTG-GD-----NMFSG----GQGGNTNEIF--WNIGGD--------DMFAFNAQAPSR 151
                |||.:| |:     ..||.    |.||.::..|  .:.||.        .:.:.......|
  Rat   126 HGLRGAFSSGFGEFPAFMEAFSSFDTLGHGGGSHSTFSSTSFGGSGSGSSGFKSVMSSTEMVNGR 190

  Fly   152 KRQQDPPIE--HDLFVSLEEVDKGCIKKMKISRMATGSNGPYKEEKVLRITVK 202
            |......:|  |:. |.:||  .|.::.:.:       ||   :||::|:..|
  Rat   191 KVTTKRIVENGHER-VEVEE--DGKLRSVTV-------NG---KEKLMRVDSK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DnaJ-1NP_523936.2 DnaJ 1..333 CDD:223560 80/248 (32%)
DnaJ 4..65 CDD:278647 35/62 (56%)
DnaJ_C 157..320 CDD:199909 12/48 (25%)
Dnajb8NP_001102718.1 DnaJ 3..66 CDD:278647 35/62 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.